Protein Info for PGA1_c06230 in Phaeobacter inhibens DSM 17395

Annotation: putative protein Smf

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 PF21102: DprA_N" amino acids 19 to 81 (63 residues), 91.6 bits, see alignment E=3e-30 TIGR00732: DNA protecting protein DprA" amino acids 81 to 295 (215 residues), 228.1 bits, see alignment E=3.8e-72 PF02481: DNA_processg_A" amino acids 83 to 286 (204 residues), 238.7 bits, see alignment E=6.2e-75 PF17782: DprA_WH" amino acids 332 to 391 (60 residues), 50.9 bits, see alignment E=1.9e-17

Best Hits

KEGG orthology group: K04096, DNA processing protein (inferred from 63% identity to rde:RD1_2132)

Predicted SEED Role

"Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EJL1 at UniProt or InterPro

Protein Sequence (412 amino acids)

>PGA1_c06230 putative protein Smf (Phaeobacter inhibens DSM 17395)
MTEEAHSSTHPPLPPTTEDIRISWLRLLRSRRVGAVTFHRLLAKYGSAQNALSALPEMAR
AAGIKGYEICSADAALAEIKAAEAANARLLCFGEADYPSHLAVLRDAPPLLWAVGDPAHL
NQPTIAIVGARNASSLGVRMARALARELGEAGYCIISGLARGIDTAAHMAALRTGTCAVM
AGGVDVIYPTENTRLAGDIAEQGVMISEHPMGMSPRARHFPARNRIIAGAAQAVVVVEGA
AKSGSLITARDALDLGRDVLAVPGHPFDARAAGCNMLIRDGAQLVRNAQDVIEALPPMDL
SHRVVAELSDRPVPPPEAAASARLTELPPPPKEQRSLSDTAALHQLILDRLGPAPTAEDQ
LVRDLAIPSRDLAPALTDLELSGAVARAAGGLLIRGDFDPDPKGAAGPKSQR