Protein Info for PGA1_c06210 in Phaeobacter inhibens DSM 17395

Annotation: probable succinyl-CoA:3-ketoacid-coenzyme A transferase subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 TIGR02429: 3-oxoacid CoA-transferase, A subunit" amino acids 1 to 222 (222 residues), 219.6 bits, see alignment E=1.7e-69 PF01144: CoA_trans" amino acids 6 to 222 (217 residues), 238.8 bits, see alignment E=2.2e-75

Best Hits

Swiss-Prot: 63% identical to SCOA_XANCB: Succinyl-CoA:3-ketoacid coenzyme A transferase subunit A (lpsI) from Xanthomonas campestris pv. campestris (strain B100)

KEGG orthology group: K01028, 3-oxoacid CoA-transferase subunit A [EC: 2.8.3.5] (inferred from 86% identity to sit:TM1040_2340)

MetaCyc: 43% identical to alpha subunit of beta-ketoadipate succinyl-CoA transferase (Pseudomonas putida)
3-oxoadipate CoA-transferase. [EC: 2.8.3.6]

Predicted SEED Role

"Succinyl-CoA:3-ketoacid-coenzyme A transferase subunit A (EC 2.8.3.5)" in subsystem Catechol branch of beta-ketoadipate pathway or Leucine Degradation and HMG-CoA Metabolism or Protocatechuate branch of beta-ketoadipate pathway or Serine-glyoxylate cycle (EC 2.8.3.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.8.3.5, 2.8.3.6

Use Curated BLAST to search for 2.8.3.5 or 2.8.3.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DMM4 at UniProt or InterPro

Protein Sequence (239 amino acids)

>PGA1_c06210 probable succinyl-CoA:3-ketoacid-coenzyme A transferase subunit A (Phaeobacter inhibens DSM 17395)
MKKVYANAAEALDGVLHDGMFIAAGGFGLCGIPELLLDAIKDAGTKDLTFASNNAGVDDF
GIGILLQTKQVKKMISSYVGENAEFMRQYLSGELELEFNPQGTLAERMRAGGAGIPGFFT
KTGVGTVIAEGKMEKQFPTGPDGAMQDYIMEEGLFADLAIVKAWKADETGNLVFRKTARN
FNVPAATCGKICVAEVEEIVPVGSLDPDSIHLPGIYVHRIIQGDHEKRIEQRTTRPAAQ