Protein Info for Psest_0614 in Pseudomonas stutzeri RCH2

Annotation: Outer membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF02321: OEP" amino acids 52 to 221 (170 residues), 76.3 bits, see alignment E=1.4e-25 amino acids 249 to 423 (175 residues), 99.4 bits, see alignment E=1.1e-32

Best Hits

Swiss-Prot: 41% identical to CZCC_CUPMC: Cobalt-zinc-cadmium resistance protein CzcC (czcC) from Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)

KEGG orthology group: None (inferred from 52% identity to gca:Galf_0927)

Predicted SEED Role

"Heavy metal RND efflux outer membrane protein, CzcC family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GIH4 at UniProt or InterPro

Protein Sequence (435 amino acids)

>Psest_0614 Outer membrane protein (Pseudomonas stutzeri RCH2)
MRKALFSLGLTTLSCNLAFAQPLELPTFTQTLPVGVSNTFPVESVESISFLRALELASSA
SPELAVARRELAASRALISQAGARPNPILSASQEGIRGDAPETTLELSQEIELGGKRSAR
IEAAQRALDVAAADLQDAQARLRGAVMGAYYDVLTAQERLDLAQAASKLAKQAVNVANRR
VRAGMVSPVEETRARVAATGVQVELAQATAELEAARTRLAANWGNPQPRFERVKEPAEAV
PPLPELAELYSRLNDSAQLTRARREAERRRAALKLERTNRFSNVTVSVGAQRSDEYNGTL
GLVSISMPLPLFDRNQGNIGAAQERAYQAQDELNAVHIRLKSELSQAHMRLRTARQQFEL
LRNDMLPSAQSAYEAASKGFELGKFTFLDVLDAQRTLFQARSQYLSALSQANQAAAEISR
IVGDGSAVITSATQP