Protein Info for Psest_0608 in Pseudomonas stutzeri RCH2

Annotation: Cd(II)/Pb(II)-responsive transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 134 TIGR02047: Cd(II)/Pb(II)-responsive transcriptional regulator" amino acids 1 to 127 (127 residues), 196.5 bits, see alignment E=7.2e-63 PF13411: MerR_1" amino acids 1 to 68 (68 residues), 70.3 bits, see alignment E=1.8e-23 PF00376: MerR" amino acids 2 to 39 (38 residues), 61.5 bits, see alignment E=7.9e-21 PF09278: MerR-DNA-bind" amino acids 45 to 108 (64 residues), 65.5 bits, see alignment E=8.1e-22

Best Hits

Swiss-Prot: 44% identical to ZNTR_HAEIN: HTH-type transcriptional regulator ZntR homolog (zntR) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 88% identity to spc:Sputcn32_0194)

Predicted SEED Role

"Transcriptional regulator, MerR family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GIR6 at UniProt or InterPro

Protein Sequence (134 amino acids)

>Psest_0608 Cd(II)/Pb(II)-responsive transcriptional regulator (Pseudomonas stutzeri RCH2)
MRIGQLARLIGIDTQTIRFYEQQGLLPPPDRQANGYRVYTEKHGERLAFIRRCRILNLSL
PEIHALQSYQDDPRQPCTAVNALLDDHISQVRSQITALQSLERQLVSLRANCNDGREVEA
CGILAGISEDACIK