Protein Info for Psest_0607 in Pseudomonas stutzeri RCH2

Annotation: Co/Zn/Cd efflux system component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 transmembrane" amino acids 123 to 142 (20 residues), see Phobius details amino acids 148 to 149 (2 residues), see Phobius details amino acids 151 to 169 (19 residues), see Phobius details amino acids 180 to 199 (20 residues), see Phobius details amino acids 210 to 230 (21 residues), see Phobius details amino acids 245 to 268 (24 residues), see Phobius details amino acids 274 to 292 (19 residues), see Phobius details PF00403: HMA" amino acids 33 to 84 (52 residues), 26.5 bits, see alignment 6.7e-10 PF01545: Cation_efflux" amino acids 124 to 292 (169 residues), 52.7 bits, see alignment E=4.9e-18

Best Hits

KEGG orthology group: None (inferred from 94% identity to psa:PST_3416)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GEP7 at UniProt or InterPro

Protein Sequence (296 amino acids)

>Psest_0607 Co/Zn/Cd efflux system component (Pseudomonas stutzeri RCH2)
MSKSDGPCGCDATPAADADMQNPSDTTGQWVSVYAVPKMDCPSEERMIRLALNGLDGVRK
LTFDLSDRRLDVMHDSAVEPITKKLATLGLGATLQKTVAADPEMIKAAENPANSTQESRS
LRLLLGINAFMFVVEMTAGLIARSAGLIADSLDMFADAAVYGLALYAVGRSVNLQVRAAH
LAGVLQLILALGVLVEVIRRFIFGSEPESLIMMAVAFLALLANTGCLLLISKHREGGAHM
KASWIFSANDVVINMGVIVAGALVAWTGSNYPDLIIGTVVGFIVLNGARRILALKG