Protein Info for PGA1_c06060 in Phaeobacter inhibens DSM 17395

Annotation: Flp pilus assembly protein, protease CpaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 35 to 55 (21 residues), see Phobius details amino acids 61 to 82 (22 residues), see Phobius details amino acids 92 to 118 (27 residues), see Phobius details amino acids 139 to 160 (22 residues), see Phobius details PF01478: Peptidase_A24" amino acids 15 to 116 (102 residues), 38.3 bits, see alignment E=8.2e-14

Best Hits

KEGG orthology group: K02278, prepilin peptidase CpaA [EC: 3.4.23.43] (inferred from 70% identity to sit:TM1040_2354)

Predicted SEED Role

"Type IV prepilin peptidase TadV/CpaA" in subsystem Widespread colonization island

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.23.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DML3 at UniProt or InterPro

Protein Sequence (168 amino acids)

>PGA1_c06060 Flp pilus assembly protein, protease CpaA (Phaeobacter inhibens DSM 17395)
MLISAHVALWFLPFVVPLCCVVALNDLRHMRIPNWTVDLLGAIFVIVGPFLMSWTDYGWQ
LLHLPIGIGLGFLCYSAGMVGAGDAKFAGAAAPFVVFGDLSVVVIIFSAMLLAGFLTHRI
AKYTPLRRLAPHWKSWDVGSKFPMGLCLGGTLVFYLVLGSQLGQTAPV