Protein Info for HP15_566 in Marinobacter adhaerens HP15

Annotation: D-alanine-D-alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01205: D-alanine--D-alanine ligase
  • amino acids 21 to 317 (297 residues), 328.7 bits, E=1.6e-102
• PF01820: Dala_Dala_lig_N
  • amino acids 70 to 103 (34 residues), 39.7 bits, 2e-13
• PF02655: ATP-grasp_3
  • amino acids 112 to 284 (173 residues), 24.9 bits, E=6.1e-09
• PF07478: Dala_Dala_lig_C
  • amino acids 122 to 314 (193 residues), 187.2 bits, E=7.8e-59
• PF02786: CPSase_L_D2
  • amino acids 126 to 286 (161 residues), 20.5 bits, E=9.4e-08

Best Hits

Swiss-Prot: 82% identical to DDL_MARHV: D-alanine--D-alanine ligase (ddl) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K01921, D-alanine-D-alanine ligase [EC: 6.3.2.4] (inferred from 82% identity to maq:Maqu_2450)

Predicted SEED Role

"D-alanine--D-alanine ligase (EC 6.3.2.4)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.4)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (12/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (6/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

• D-Alanine metabolism
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.4

Sequence Analysis Tools

See E4PP18 at UniProt or InterPro

Protein Sequence (323 amino acids)

>HP15_566 D-alanine-D-alanine ligase (Marinobacter adhaerens HP15)
MHHGEPQAYQADPELVRSLGRVAVFMGGDSAEREVSLKSGKAVLAALVSAGVDAFAVDVR
GCLLRTVDNPDFDRVFIALHGRGGEDGTLQAILSQAGIPYTGSDVLASALAMDKLRTKYV
FEGCGLPTPKFRTMSGADQAEQIIDELRAPLSVKPSREGSSIGIRKVHTAAELAHAYEAA
AALDNLVLVEEWIEGPEFTVSLLQDRALPAIGLSASTEHVFYDYEAKYLADDTRYRIPCG
LAPEDEVRLQHLALEAFRVVGCRTWGRVDIMQDSDGKFWLLEVNTVPGMTDHSLVPMAAK
AAGISFEELVVRILKDSLEDANA