Protein Info for HP15_564 in Marinobacter adhaerens HP15

Annotation: UDP-N-acetylglucosamine--N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (Undecaprenyl-PP-MurNAc-pentapeptide-UDPGlcNAc GlcNAc transferase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR01133: undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase" amino acids 2 to 353 (352 residues), 367.6 bits, see alignment E=3.2e-114 PF03033: Glyco_transf_28" amino acids 7 to 144 (138 residues), 136.6 bits, see alignment E=6.2e-44 PF04101: Glyco_tran_28_C" amino acids 187 to 350 (164 residues), 135.1 bits, see alignment E=2.6e-43

Best Hits

Swiss-Prot: 82% identical to MURG_MARHV: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (murG) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K02563, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [EC: 2.4.1.227] (inferred from 82% identity to maq:Maqu_2452)

Predicted SEED Role

"UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (EC 2.4.1.227)" in subsystem Peptidoglycan Biosynthesis (EC 2.4.1.227)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.227

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PP16 at UniProt or InterPro

Protein Sequence (361 amino acids)

>HP15_564 UDP-N-acetylglucosamine--N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (Undecaprenyl-PP-MurNAc-pentapeptide-UDPGlcNAc GlcNAc transferase) (Marinobacter adhaerens HP15)
MTEQRRFLMMAGGTGGHVFPALATARALEARGHQVYWLGASGGMEQRLIGETDIPLSLIH
ISGLRGKGKLALLLAPFRLMRALGEAFTILRRIRPDCVVGMGGFVTGPGGVAAWLNRTPL
VIHEQNAIAGMTNRILVRFAETVLEAFPGSFGPKVVTRCTGNPVREDLASLPVPEKRLAD
REGALRLLVIGGSLGAQVFNEQLPEALAMLPEGDRPVVRHQCGERHAEAAKQAYEEHGVA
AAVEPFIKDMAEAYQWADLVLCRAGALTVSELCAAGIGAVLVPFPHAVDDHQTKNGQQMV
SAKAAILIPQAKMTPAVLAETLGDLARNRDRVNEMAKAARTLARPDATERVVNYCLEAAN
G