Protein Info for PGA1_c05940 in Phaeobacter inhibens DSM 17395

Annotation: putative peptidoglycan-associated lipoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 169 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR02802: peptidoglycan-associated lipoprotein" amino acids 61 to 162 (102 residues), 138.6 bits, see alignment E=3.5e-45 PF00691: OmpA" amino acids 62 to 151 (90 residues), 78.9 bits, see alignment E=1.6e-26

Best Hits

Swiss-Prot: 48% identical to PAL_BRUSU: Peptidoglycan-associated lipoprotein (pal) from Brucella suis biovar 1 (strain 1330)

KEGG orthology group: K03640, peptidoglycan-associated lipoprotein (inferred from 70% identity to sit:TM1040_2364)

Predicted SEED Role

"Outer membrane lipoprotein omp16 precursor" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DY15 at UniProt or InterPro

Protein Sequence (169 amino acids)

>PGA1_c05940 putative peptidoglycan-associated lipoprotein (Phaeobacter inhibens DSM 17395)
MSGLTKAMLVAAALGLSACAGNPWDDTAGGNGSGAGAGAGAAGQLDPSSPAYFQQTVGDR
VLFAVDQSTLSPAAQSVLQGQARWLTANPDYVVTIEGHADEQGTREYNLALGARRANAAR
EYLLSQGVAGNRLQVVSFGKERPLEICSNEACYTKNRRAVTVLAGGLTG