Protein Info for HP15_58 in Marinobacter adhaerens HP15
Annotation: GTP cyclohydrolase 1
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 77% identical to GCH11_PSEAE: GTP cyclohydrolase 1 1 (folE1) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
KEGG orthology group: K01495, GTP cyclohydrolase I [EC: 3.5.4.16] (inferred from 80% identity to pmk:MDS_3591)Predicted SEED Role
"GTP cyclohydrolase I (EC 3.5.4.16) type 1" in subsystem Folate Biosynthesis or Molybdenum cofactor biosynthesis or Pterin biosynthesis or Queuosine-Archaeosine Biosynthesis (EC 3.5.4.16)
MetaCyc Pathways
- superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
- superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
- tetrahydromonapterin biosynthesis (3/4 steps found)
- 6-hydroxymethyl-dihydropterin diphosphate biosynthesis IV (Plasmodium) (2/3 steps found)
- 6-hydroxymethyl-dihydropterin diphosphate biosynthesis I (3/5 steps found)
- preQ0 biosynthesis (2/4 steps found)
- superpathway of chorismate metabolism (41/59 steps found)
- erythro-tetrahydrobiopterin biosynthesis I (1/4 steps found)
- threo-tetrahydrobiopterin biosynthesis (1/4 steps found)
- drosopterin and aurodrosopterin biosynthesis (3/7 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 3.5.4.16
Use Curated BLAST to search for 3.5.4.16
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See E4PIB7 at UniProt or InterPro
Protein Sequence (209 amino acids)
>HP15_58 GTP cyclohydrolase 1 (Marinobacter adhaerens HP15) MFYSEMKTLGSLRSSELKKREKVMSLENLTKQYEEILMGLDPNPSRNGLVGTPQRAAKAM QFLCRGYDQSLDEVVNGALFESDNDEMVLVKDIELYSLCEHHMLPFVGKAHVAYIPSGKV IGLSKVARIVDMFARRLQIQENLTREIAEALQSVTQADGVAVVIEARHMCMMMRGVEKQN SKMYSSVMLGAFRESVNTRQEFLQLVSRG