Protein Info for PGA1_c05900 in Phaeobacter inhibens DSM 17395

Annotation: protein TolQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 transmembrane" amino acids 25 to 46 (22 residues), see Phobius details amino acids 135 to 162 (28 residues), see Phobius details amino acids 178 to 200 (23 residues), see Phobius details TIGR02796: protein TolQ" amino acids 15 to 227 (213 residues), 274.7 bits, see alignment E=3e-86 PF01618: MotA_ExbB" amino acids 87 to 215 (129 residues), 127.4 bits, see alignment E=1.4e-41

Best Hits

KEGG orthology group: K03562, biopolymer transport protein TolQ (inferred from 85% identity to sit:TM1040_2368)

Predicted SEED Role

"MotA/TolQ/ExbB proton channel family protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EWV1 at UniProt or InterPro

Protein Sequence (231 amino acids)

>PGA1_c05900 protein TolQ (Phaeobacter inhibens DSM 17395)
MEAETLALAQEIDFSMWGLFARATLTVKLVMLMLVVASIWSWAIILQKLINYRLARREAA
EFDRAFWSGEPLDGLFDQIGPQPKGQSQRIFAAGMTEWRRSHRTDGALIAGAQARIERSM
DVAIAKESEHVQSGLSILATVGSTAPFVGLFGTVWGIMTAFIEIAEQQNTNLAVVAPGIA
EALMATGLGLLAAIPAVIFYNKLSADSDRIIGSYEAFADEFSTILSRQLDS