Protein Info for HP15_559 in Marinobacter adhaerens HP15

Annotation: UDP-N-acetylmuramyl-tripeptide synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 485 TIGR01085: UDP-N-acetylmuramyl-tripeptide synthetase" amino acids 13 to 478 (466 residues), 527.4 bits, see alignment E=1.9e-162 PF01225: Mur_ligase" amino acids 14 to 91 (78 residues), 26 bits, see alignment E=1.4e-09 PF08245: Mur_ligase_M" amino acids 104 to 305 (202 residues), 182.5 bits, see alignment E=1.4e-57 PF02875: Mur_ligase_C" amino acids 328 to 454 (127 residues), 126.8 bits, see alignment E=1.4e-40

Best Hits

Swiss-Prot: 51% identical to MURE_PSEAE: UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase (murE) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01928, UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase [EC: 6.3.2.13] (inferred from 77% identity to maq:Maqu_2457)

Predicted SEED Role

"UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC 6.3.2.13)" in subsystem Methicillin resistance in Staphylococci or Peptidoglycan Biosynthesis (EC 6.3.2.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PP11 at UniProt or InterPro

Protein Sequence (485 amino acids)

>HP15_559 UDP-N-acetylmuramyl-tripeptide synthetase (Marinobacter adhaerens HP15)
MQGIVAVPSVFDVTIHGLKTDSREVASGDAFIALSGARTPADFYVDKAIAAGATVILLEA
QQAGECTEHHGALIVPVAGLRSLVGRIADRFFEHPSQRLRLIGVTGTNGKTSVCQYVAQL
LKETGTPCGILGTLGYGMPGALQPATHTTPDAVQVNRVLSRIVKQEGRAAVMEVSSHALD
QGRVDNLSMTGAVFTNLTRDHLDYHGSMEAYGAAKAQLFQREELHFSVINFDDPFGRQLF
EQLDGKCDRVRYSLHEAQTELWLREFRPTDEGFEAEVDGEWGRFVVSVPLMGSFNASNVL
AAMATVLTLGVPIERVQQAVGRLTPPPGRLERFVGANGVRVVVDYAHTPDALANALTALR
PHVTGELVCVFGCGGDRDAGKRPEMAREAERLADRVVVTDDNPRSEDPETIAEHILAGFT
DAARVSVIHDRAEAIRSTIRSATPNDVVLIAGKGHEAYQEIAGQKYPFSDAEQVRHVLKL
NGGVA