Protein Info for PGA1_c05860 in Phaeobacter inhibens DSM 17395

Annotation: holliday junction ATP-dependent DNA helicase RuvA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 PF01330: RuvA_N" amino acids 1 to 62 (62 residues), 72.4 bits, see alignment E=3.8e-24 PF14520: HHH_5" amino acids 73 to 130 (58 residues), 46.2 bits, see alignment E=7.5e-16 PF07499: RuvA_C" amino acids 184 to 226 (43 residues), 31.6 bits, see alignment 2.8e-11

Best Hits

Swiss-Prot: 81% identical to RUVA_RUEPO: Holliday junction ATP-dependent DNA helicase RuvA (ruvA) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K03550, holliday junction DNA helicase RuvA (inferred from 81% identity to sit:TM1040_2372)

Predicted SEED Role

"Holliday junction DNA helicase RuvA" in subsystem DNA-replication or RuvABC plus a hypothetical

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DMJ6 at UniProt or InterPro

Protein Sequence (229 amino acids)

>PGA1_c05860 holliday junction ATP-dependent DNA helicase RuvA (Phaeobacter inhibens DSM 17395)
MIGKLTGRLEYRSSDHVLIDVRGVGYIVYCSDRTMATLPGTGEAVALYTDMVVREDLMQL
YGFPSLMEKEWHRLLTSVQGVGAKVSLAILGTLGPEGVSRAIALGDWATVKAAKGVGPKT
AQRIVLDLKDKAPGVMAMGGTIADAMDGPGLDVVESVAPVEAGKTPRKAPPKAPSGAAAA
SAGALSALGNLGYGPSDAAAAVAEAAATYPDANEAELIRAALRLLAPKG