Protein Info for HP15_554 in Marinobacter adhaerens HP15

Annotation: tetrapyrrole methylase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 PF00590: TP_methylase" amino acids 21 to 221 (201 residues), 121.1 bits, see alignment E=6.9e-39 TIGR00096: 16S rRNA (cytidine(1402)-2'-O)-methyltransferase" amino acids 22 to 293 (272 residues), 299.3 bits, see alignment E=1.3e-93 PF23016: RsmI_C" amino acids 252 to 296 (45 residues), 66.1 bits, see alignment 2e-22

Best Hits

Swiss-Prot: 57% identical to RSMI_PSEAE: Ribosomal RNA small subunit methyltransferase I (rsmI) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K07056, (no description) (inferred from 68% identity to maq:Maqu_2462)

Predicted SEED Role

"rRNA small subunit methyltransferase I" in subsystem Heat shock dnaK gene cluster extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PNK0 at UniProt or InterPro

Protein Sequence (298 amino acids)

>HP15_554 tetrapyrrole methylase family protein (Marinobacter adhaerens HP15)
MKNEVSDYPSSDSRRDEPGGTLYVVATPIGNLDDLSPRATRTLAHVDVVAAEDTRHSGRL
LSHLGIQKRMIALHDHNEKDRAAGILAELKAGRDVALISDAGTPLISDPGYVLVRDARAA
GYRVSPIPGPCALVVALSAAGLPTDRFLYVGFLPAKRSGRRASLEPLASEPATLVFYESP
HRILESVRDIAEVLGEDREMVLGREITKTFETFYSGSVAEVLAELEQDPHGTRGEFVVMV
RGAMAQPGNDDAATMDVDRVLRVLLAELPVKKVAKMASELTGLSKNELYQRALALKDS