Protein Info for PGA1_c05800 in Phaeobacter inhibens DSM 17395

Annotation: YeeE/YedE family (DUF395).

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 transmembrane" amino acids 14 to 32 (19 residues), see Phobius details amino acids 55 to 75 (21 residues), see Phobius details amino acids 90 to 109 (20 residues), see Phobius details amino acids 125 to 147 (23 residues), see Phobius details amino acids 175 to 194 (20 residues), see Phobius details amino acids 203 to 226 (24 residues), see Phobius details amino acids 254 to 277 (24 residues), see Phobius details amino acids 296 to 316 (21 residues), see Phobius details amino acids 322 to 345 (24 residues), see Phobius details PF04143: Sulf_transp" amino acids 34 to 340 (307 residues), 174.1 bits, see alignment E=2.7e-55

Best Hits

KEGG orthology group: None (inferred from 77% identity to sil:SPO3123)

Predicted SEED Role

"YeeE/YedE family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EWU2 at UniProt or InterPro

Protein Sequence (354 amino acids)

>PGA1_c05800 YeeE/YedE family (DUF395). (Phaeobacter inhibens DSM 17395)
MPELVEIMDWAGESVTAALLGLLTGGIFGVAAQRSRFCLRAATVEFARGRLGDRVAVWLL
TFSTALVWVQAGRLLGWIDTDEARMMAVPGSWSGAIIGGLIFGVGMVLARGCSGRLLVLA
ATGNLRSVVSGLIFAVVAQMSLAGYLAPVRDYLAGLWITSGGRNMDLLTALSLPDWSGLA
LGVGMAGLALGVSLHNRIGAARLIFASGVGFAVALGWALTTALAQVAFDPVQIESVTFTG
PSARMLMFFLDRAAVLEFDIGLVAGVFGGAMLAAALAGEMRIQAFDGAVTMRKAMIGAAL
MGFGGMLAGGCAIGAGVTGGSIFAGTAWLALFSMWVGAVLTDLLVDQRGVAAPA