Protein Info for HP15_546 in Marinobacter adhaerens HP15

Annotation: ubiquinol-cytochrome c reductase, cytochrome b

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 transmembrane" amino acids 33 to 55 (23 residues), see Phobius details amino acids 84 to 105 (22 residues), see Phobius details amino acids 117 to 139 (23 residues), see Phobius details amino acids 145 to 163 (19 residues), see Phobius details amino acids 184 to 206 (23 residues), see Phobius details amino acids 245 to 269 (25 residues), see Phobius details amino acids 290 to 308 (19 residues), see Phobius details amino acids 314 to 334 (21 residues), see Phobius details amino acids 346 to 367 (22 residues), see Phobius details amino acids 376 to 395 (20 residues), see Phobius details PF00033: Cytochrome_B" amino acids 24 to 211 (188 residues), 218.2 bits, see alignment E=1.4e-68 PF13631: Cytochrom_B_N_2" amino acids 93 to 263 (171 residues), 145.1 bits, see alignment E=3.1e-46 PF00032: Cytochrom_B_C" amino acids 277 to 386 (110 residues), 135.2 bits, see alignment E=1.4e-43

Best Hits

Swiss-Prot: 68% identical to CYB_ALLVD: Cytochrome b (petB) from Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)

KEGG orthology group: K00412, ubiquinol-cytochrome c reductase cytochrome b subunit [EC: 1.10.2.2] (inferred from 94% identity to maq:Maqu_2469)

MetaCyc: 49% identical to cytochrome b (Acidithiobacillus ferrooxidans)
RXN-15829 [EC: 7.1.1.8]

Predicted SEED Role

"Ubiquinol--cytochrome c reductase, cytochrome B subunit (EC 1.10.2.2)" in subsystem Ubiquinone Menaquinone-cytochrome c reductase complexes (EC 1.10.2.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.10.2.2

Use Curated BLAST to search for 1.10.2.2 or 7.1.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PNJ2 at UniProt or InterPro

Protein Sequence (410 amino acids)

>HP15_546 ubiquinol-cytochrome c reductase, cytochrome b (Marinobacter adhaerens HP15)
MSKLLNWVDERLPVIDAWNKHLGKYYAPKNFNLWYFFGSLAMLVLVNQLVTGIWLTMSYN
PSAEGAFASVEYIMRDVEWGWLLRYLHSTGASAFFIVVYLHMFRGLMYGSYQKPRELIWI
FGMLIYLILMAEAFMGYLLPWGQMSYWGAQVIVNLFGAIPVIGEDLSLWIRGDYLISGIT
LNRFFALHVVALPIVLLGLVVLHILALHEVGSNNPDGIDIKKNKDENGIPKDGIPFHPYY
TVHDLLGVGVFFFIFFIVVFFFPEGGGLFIEKPNFEPANPLKTPNHIAPVWYFTPFYAML
RAVTIDLFGLDAKFWGVVVMGAAIAILFVLPWLDKSPVRSMRYKGWLSRIALAIFVVSFV
ILGYLGLVPATEGRTMVAQVLTVLYFLYFILMPFYTRMEKTKPVPERVTG