Protein Info for Psest_0554 in Pseudomonas stutzeri RCH2

Annotation: Signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 PF01590: GAF" amino acids 17 to 151 (135 residues), 46.7 bits, see alignment E=7e-16 PF00512: HisKA" amino acids 173 to 236 (64 residues), 57.6 bits, see alignment E=1.6e-19 PF02518: HATPase_c" amino acids 284 to 391 (108 residues), 85.2 bits, see alignment E=6.5e-28

Best Hits

KEGG orthology group: None (inferred from 92% identity to psa:PST_3730)

Predicted SEED Role

"Sensor histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GGM6 at UniProt or InterPro

Protein Sequence (393 amino acids)

>Psest_0554 Signal transduction histidine kinase (Pseudomonas stutzeri RCH2)
MARSILDDLLTVQRISAVPAILQVVSETTGLRFAAVARVTEDSWTACAVLDRIEFGLKVG
GELDVTTTLCSEIHASQQPIIISQVSADPGYCNHHTPQMYGFESYISVPVLRADGSFFGT
LCALDPLPRDLSSPATPAMFESFARLLTLQIEAEEQQQATRAALADERITGHQREQFIAL
LGHDLRTPLASIQAASDLLVRRSTEPGTQRLAEHVRTSSQRASRMVDDLLDFARGQLGNG
IPLNWTASANLHLVLSQVVNELRTAYPRRVLLEQLPELSVFECDPDRIAQLLANLITNAL
HHGASTGPVIVNAEVVDGHFQLSVHNRGTPIPAERLEQLFHAYSQEDDTSRNGLGLGLFI
VEQVAKAHGGRMQVNSSADAGTTFTFSMPVRRD