Protein Info for HP15_536 in Marinobacter adhaerens HP15

Annotation: ferric reductase domain protein protein transmembrane component, N-terminal domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 51 to 69 (19 residues), see Phobius details amino acids 85 to 107 (23 residues), see Phobius details amino acids 119 to 135 (17 residues), see Phobius details amino acids 154 to 171 (18 residues), see Phobius details amino acids 178 to 194 (17 residues), see Phobius details PF01794: Ferric_reduct" amino acids 52 to 163 (112 residues), 66 bits, see alignment E=1.7e-22

Best Hits

Swiss-Prot: 39% identical to MSRQ_RHORT: Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ (msrQ) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: None (inferred from 64% identity to maq:Maqu_0887)

MetaCyc: 35% identical to membrane-bound flavocytochrome MsrQ (Escherichia coli K-12 substr. MG1655)
1.8.5.M7 [EC: 1.8.5.M7]; 1.8.5.M7 [EC: 1.8.5.M7]

Predicted SEED Role

"FIG001196: Membrane protein YedZ"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.5.M7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PNI2 at UniProt or InterPro

Protein Sequence (207 amino acids)

>HP15_536 ferric reductase domain protein protein transmembrane component, N-terminal domain protein (Marinobacter adhaerens HP15)
MNEKRVLNQPGFVLAFRLLVALLASVPLLVLIASIASQSLGPDPGQEVTESLGIAAFQLL
IATLCMTPLKRWTGWGAWIRVRRMLGLFAFFYAVLHVLAFLQFILGWSDLWATFTKRPYI
LAGAVSFLMLVPLALTSTKGMMRRMGRQWKGLHKLVYPIAIAAWVHFIWQSRSDVGEMVV
YGLIIAVLLALRWKWSGSRALIPFVRG