Protein Info for PGA1_c05510 in Phaeobacter inhibens DSM 17395

Annotation: glyceraldehyde-3-phosphate dehydrogenase 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00044: Gp_dh_N
  • amino acids 25 to 125 (101 residues), 89.7 bits, E=1.3e-29
• PF02800: Gp_dh_C
  • amino acids 178 to 332 (155 residues), 141.9 bits, E=1.4e-45

Best Hits

Swiss-Prot: 40% identical to G3P1_BACSU: Glyceraldehyde-3-phosphate dehydrogenase 1 (gapA) from Bacillus subtilis (strain 168)

KEGG orthology group: K00134, glyceraldehyde 3-phosphate dehydrogenase [EC: 1.2.1.12] (inferred from 78% identity to sil:SPO0875)

MetaCyc: 39% identical to D-erythrose-4-phosphate dehydrogenase (Escherichia coli K-12 substr. MG1655)
Erythrose-4-phosphate dehydrogenase. [EC: 1.2.1.72]

Predicted SEED Role

"NAD-dependent glyceraldehyde-3-phosphate dehydrogenase (EC 1.2.1.12)" in subsystem Calvin-Benson cycle or Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Pyridoxin (Vitamin B6) Biosynthesis or Redox-dependent regulation of nucleus processes (EC 1.2.1.12)

MetaCyc Pathways

• gluconeogenesis I (12/13 steps found)
• superpathway of glucose and xylose degradation (14/17 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (14/17 steps found)
• Entner-Doudoroff pathway I (8/9 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (20/26 steps found)
• Bifidobacterium shunt (12/15 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (17/22 steps found)
• glycolysis II (from fructose 6-phosphate) (9/11 steps found)
• glycolysis III (from glucose) (9/11 steps found)
• pyridoxal 5'-phosphate biosynthesis I (6/7 steps found)
• glycolysis I (from glucose 6-phosphate) (10/13 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• gluconeogenesis III (9/12 steps found)
• homolactic fermentation (9/12 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (14/19 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• heterolactic fermentation (13/18 steps found)
• glycolysis IV (7/10 steps found)
• superpathway of N-acetylneuraminate degradation (15/22 steps found)
• glycolysis VI (from fructose) (7/11 steps found)
• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (7/12 steps found)
• superpathway of hexitol degradation (bacteria) (11/18 steps found)
• glycerol degradation to butanol (9/16 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Glycolysis / Gluconeogenesis
• Vitamin B6 metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.12

Use Curated BLAST to search for 1.2.1.12 or 1.2.1.72

Sequence Analysis Tools

See I7EJG3 at UniProt or InterPro

Protein Sequence (353 amino acids)

>PGA1_c05510 glyceraldehyde-3-phosphate dehydrogenase 1 (Phaeobacter inhibens DSM 17395)
MTETGGRLPLLRIEPDAAPCHSLAMKLAINGFGRIGRAILRQILTTPRGVGIELVCINDI
APLDMCAYLFQYDSTFGPYPDAVVVDGDSLRIADRVIRFHQSADLSKLDLSGVDVVLECT
GIARTSDVAGRGLSAGARKVLISGPSPAAERTVVLGANEADLGDGRIISNASCTTNGLAP
LVKLLDAELGITSAHMTTIHCYTNSQPMVDAPRGDFARSRGGALSMVPTTTSATHLIDEV
LPHLAGRISGAAVRVPTASVSAVDLVVQTERPMQGDQVQKALRAAVEAAPVLGWTDQPLV
SSDLRARPESLVIAGPETRVTGPHQLRMFGWYDNEWGFSARMLDMARLMAGDA