Protein Info for PGA1_c05500 in Phaeobacter inhibens DSM 17395

Annotation: putative purine permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 transmembrane" amino acids 32 to 52 (21 residues), see Phobius details amino acids 64 to 84 (21 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 118 to 140 (23 residues), see Phobius details amino acids 148 to 171 (24 residues), see Phobius details amino acids 186 to 205 (20 residues), see Phobius details amino acids 212 to 234 (23 residues), see Phobius details amino acids 257 to 279 (23 residues), see Phobius details amino acids 301 to 319 (19 residues), see Phobius details amino acids 336 to 359 (24 residues), see Phobius details amino acids 367 to 389 (23 residues), see Phobius details amino acids 398 to 416 (19 residues), see Phobius details amino acids 426 to 448 (23 residues), see Phobius details TIGR00801: uracil-xanthine permease" amino acids 19 to 447 (429 residues), 316.9 bits, see alignment E=2.2e-98 PF00860: Xan_ur_permease" amino acids 23 to 413 (391 residues), 280.9 bits, see alignment E=7e-88 TIGR03173: xanthine permease" amino acids 27 to 449 (423 residues), 420.7 bits, see alignment E=5.4e-130

Best Hits

KEGG orthology group: K03458, nucleobase:cation symporter-2, NCS2 family (inferred from 88% identity to sil:SPO0874)

Predicted SEED Role

"Uracil-xanthine permease" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EUB4 at UniProt or InterPro

Protein Sequence (475 amino acids)

>PGA1_c05500 putative purine permease (Phaeobacter inhibens DSM 17395)
MADGSIGTPAQLRDPNYTPPLAKAVPLGIQHVLAMFVSNVTPAIIVAGAAGFGFGSNSPD
FPELLYLIQMSMLFAGAATLLQTLTIGPVGAALPIVQGTSFAFLPIMIPLVAGKGVDALA
ALFGGVLIGGLFHAALGLVIGRIRFALPPLVTGLVVTMIGLALVKVGIQYAAGGVPAIGT
PEYGSLLNWSAALVVVIVTLGLKFFARGMLSISAVLLGLIVGYLYAMMMGMVTAEAIGNS
WSRASAFALPVPFKYGIEFSAAAILGFCLMGLVSAVETVGDVSGIARGGAGREATDREIA
GATYADGFGSALAGVFGGLPNTSFSQNVGLIAMTGVMSRHVVTIGALFLILCGLVPKVGA
IIRTIPIEVLGGGVIVMFGMVVAAGISMLSDVDWNRRNMVIFAISLSIGLGLQLEPGAVQ
HLPDTLRILMTSGLLPAALIAIVLNLVLPQELASESTEEVSGGLSGQGRGSLPGE