Protein Info for PGA1_c05480 in Phaeobacter inhibens DSM 17395

Annotation: OHCU decarboxylase domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 TIGR03212: putative urate catabolism protein" amino acids 4 to 301 (298 residues), 530.6 bits, see alignment E=9.1e-164 PF01522: Polysacc_deac_1" amino acids 74 to 183 (110 residues), 39 bits, see alignment E=7.3e-14 PF09349: OHCU_decarbox" amino acids 309 to 467 (159 residues), 157.4 bits, see alignment E=4.4e-50 TIGR03164: OHCU decarboxylase" amino acids 310 to 469 (160 residues), 214.9 bits, see alignment E=6.3e-68

Best Hits

KEGG orthology group: None (inferred from 84% identity to sit:TM1040_3475)

Predicted SEED Role

"Uricase (EC 1.7.3.3)" (EC 1.7.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.7.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EWS1 at UniProt or InterPro

Protein Sequence (471 amino acids)

>PGA1_c05480 OHCU decarboxylase domain-containing protein (Phaeobacter inhibens DSM 17395)
MNRYPRNMIGYGATPPDAAWPGAAKVAVQFVLNYEEGGENNVLHGDAGSEAFLSDIAGAA
SWPGQRHWNMESIYDYGARAGFWRLHRMFTAANIPLTIYGVASALARSPEQVAAMKAADW
EIASHGLKWVEHKDMPEEEERAAIAEAIRLHTEVVGTRPRGWYTGRCSENTVRLVAEEGG
FDYISDTYDDDLPYWLEVGERDQLIIPYTLEANDMRFATAPGYITGQQFYQYLKDAFDLL
YAEGEAGAPKMMSVGLHCRLIGRPGKAAGLKRFIDYIQGFDGVWCPRRIDIADHWAKTHP
HQRRERPSQMSRARFVEAYGGIFEHSPWIAERAHDLELGPAHDRAAGLHNALCRMFRSAS
EEERLGVLTAHPDLAGKLAAAKRLTAESTTEQASAGLDALTDAERTRFTQLNTAYVEKHG
FPFIIAVRDHDKASILAAFERRIGHDRTREFAEACRQVERIAEFRLKDLLP