Protein Info for HP15_524 in Marinobacter adhaerens HP15

Annotation: signal transduction histidine kinase, nitrogen specific, NtrB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 551 transmembrane" amino acids 34 to 54 (21 residues), see Phobius details amino acids 64 to 86 (23 residues), see Phobius details amino acids 93 to 111 (19 residues), see Phobius details amino acids 116 to 133 (18 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 167 to 185 (19 residues), see Phobius details PF00512: HisKA" amino acids 328 to 392 (65 residues), 60.3 bits, see alignment E=1.6e-20 PF02518: HATPase_c" amino acids 438 to 544 (107 residues), 72.5 bits, see alignment E=3.7e-24

Best Hits

KEGG orthology group: K02668, two-component system, NtrC family, sensor histidine kinase PilS [EC: 2.7.13.3] (inferred from 78% identity to maq:Maqu_0875)

Predicted SEED Role

"Two-component sensor PilS" in subsystem Type IV pilus

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PNH0 at UniProt or InterPro

Protein Sequence (551 amino acids)

>HP15_524 signal transduction histidine kinase, nitrogen specific, NtrB (Marinobacter adhaerens HP15)
MAADTPVRSAEALGPAPSTPPGIQQAKLFRIYNHYRLVVSLMLVALLFVDPVNFDMRFRL
LDYYQAGVSAYLGLNAFIALLLIAGFHPSQRHITLSILLDILIMHGLLLASTGITNGLAN
LVIVSVAAGNILTPSRMGTFYAALAAICSLGISGWAVLTLGESADDIVRAGSLGILYFAA
AFVLQSISRRMMRSEALATSRARSIAELEKINQQIIQRMRTGILVLDRFGQIRLANAAAE
ELLYGAPKASAPIHERATVLPKPLKQGLDAWLKDPTQRIEPFQPSPTSPLLQVNFTQLDQ
ERGDQILVFIEDMSKVTQQAQQMKLASLGRLTAGIAHEIRNPLGAISHAAQLMEESPNLD
PGDHQMLGIIRRHSRRVNGIIENVLDLSRRRAANADLIEVAPWLQEFKEDFLQTQNEGRA
EADIILKIDPQLPSARFDKSQIEQVMVNLCDNGLRYSEQHSGQRRIGIHAGATEDGERTY
IDVRDQGPGIAPEHRNSVFEPFFTTDKTGTGLGLYLARELCEANQAHLSLVEDNKPGCCF
RITFAHPGRMI