Protein Info for HP15_523 in Marinobacter adhaerens HP15

Annotation: two component, sigma54 specific, transcriptional regulator, Fis family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 PF00072: Response_reg" amino acids 7 to 115 (109 residues), 100 bits, see alignment E=1.8e-32 PF00158: Sigma54_activat" amino acids 138 to 304 (167 residues), 231.8 bits, see alignment E=7.7e-73 PF14532: Sigma54_activ_2" amino acids 139 to 309 (171 residues), 87.4 bits, see alignment E=2.2e-28 PF02954: HTH_8" amino acids 419 to 459 (41 residues), 59.4 bits, see alignment 4.5e-20

Best Hits

Swiss-Prot: 65% identical to PILR_PSEAE: Type 4 fimbriae expression regulatory protein PilR (pilR) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02667, two-component system, NtrC family, response regulator PilR (inferred from 84% identity to maq:Maqu_0874)

Predicted SEED Role

"Type IV fimbriae expression regulatory protein PilR" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PNG9 at UniProt or InterPro

Protein Sequence (462 amino acids)

>HP15_523 two component, sigma54 specific, transcriptional regulator, Fis family (Marinobacter adhaerens HP15)
MTKYTALIVDDEPDIRELLEITLTRMGITTLTAPDLTSAQKLLEQNTTHLCLTDMNLPDG
NGIELVQWIQKHSPATPVAVITAYGNMDTAIESLKAGAFDFVSKPVELPRLRELVNSALK
LAEPKADAEDTADEPGLLLGKSPEIRKLRNQTRKLARSQAPVFISGESGSGKELVARMIH
LQGPRREGPFIAVNCGAIPSELMESEFFGHKKGSFTGAVENKDGLFRSANGGTLFLDEVA
DLPLAMQVKLLRAIQEKAVRPVGDTKEVPVDIRVLSATHKNLPELVQEGSFRQDLFYRIN
VIELSVPPLRERPDDISLLSNHILERIAKEYECDPASLTPAAVDRLRSYDFPGNVRELEN
VLERAFTLCDADQIDADDLHLGNGVQHAASASQIIAEGQVGDGEGIAVPDGEIDLEGYLE
KIERQAIEKALEATRWNKTAAAKRLGISFRALRYRLKKLGME