Protein Info for PGA1_c05440 in Phaeobacter inhibens DSM 17395

Annotation: surface antigen-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 647 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 53 to 73 (21 residues), see Phobius details PF01103: Omp85" amino acids 454 to 647 (194 residues), 101.5 bits, see alignment E=7.2e-33

Best Hits

KEGG orthology group: K07278, outer membrane protein (inferred from 59% identity to sit:TM1040_2395)

Predicted SEED Role

"Outer membrane protein assembly factor YaeT precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DMG1 at UniProt or InterPro

Protein Sequence (647 amino acids)

>PGA1_c05440 surface antigen-like protein (Phaeobacter inhibens DSM 17395)
MLGVIPVPTFASGTRYPPEAQGRFCLFGAFMFYCRALLRSVFDMPRRSRLGQFGRCIICA
ASLSFGSAAALSAAEARLVAPGSDGDLRDLLQDASATLATSARGETGVQPLMAAALSDYR
TLVQVLYDQGYFSPVVQIRVDGREAARIQPLNLPREIKSIEITVKAGQKFTFGTAEISPL
PQKRTVDIPEDFATGRTATTAVLRDAANAGVENWRYAGHPQAEVGGQSITANHVAARLDA
RLRLAPGPQLRFGRLQLANPSAVRAEAIQRIAGFPTGEVFHPDLLSRSATRLRRTGAFSA
VTIRPAERANPDGTLDYVARIEDQPPRRFTFGAELSSSDGLEVSGSWMHRNLFGGAERLR
FEARLSGIGSANDLDGRVAVRLDRPAAFGPDDSQFYLLEAEKLDEEHYSATRGLGAVGVR
RVYSDRLFAEAALGFESVLAEDVFGKRRFKYLVGQLRAEYDGRDSSLSATSGYYLDARAV
PFIGIDGSKSGVQLKFDGRAYKGFGSDDRIVLAGRLQMGSVIGPSLSEVSPTLLFYSGGA
GSVRGHEFQSLGVPAGGGTSGGRGYLALSGEVRGRIGEKFTLVGFYDVGLVDADSFVSSD
SARHAGAGVGLRYDVAGIGAIRLDLAYPVDGGSDDGLQFYIGIGQAF