Protein Info for Psest_0536 in Pseudomonas stutzeri RCH2

Annotation: thiamine-phosphate pyrophosphorylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 PF02581: TMP-TENI" amino acids 10 to 190 (181 residues), 188.5 bits, see alignment E=3.7e-60 TIGR00693: thiamine-phosphate diphosphorylase" amino acids 10 to 201 (192 residues), 198.3 bits, see alignment E=4e-63

Best Hits

Swiss-Prot: 92% identical to THIE_PSEU5: Thiamine-phosphate synthase (thiE) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K00788, thiamine-phosphate pyrophosphorylase [EC: 2.5.1.3] (inferred from 92% identity to psa:PST_3757)

MetaCyc: 36% identical to thiamine phosphate synthase (Bacillus subtilis subtilis 168)
Thiamine-phosphate diphosphorylase. [EC: 2.5.1.3]; 2.5.1.3 [EC: 2.5.1.3]

Predicted SEED Role

"Thiamin-phosphate pyrophosphorylase (EC 2.5.1.3)" in subsystem Thiamin biosynthesis (EC 2.5.1.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GEI6 at UniProt or InterPro

Protein Sequence (213 amino acids)

>Psest_0536 thiamine-phosphate pyrophosphorylase (Pseudomonas stutzeri RCH2)
MKDSTRLRGLYAITDSKLLADGRLLPYVEAALKGGARLLQYRDKSSDEARRLREADALQE
LCARHGAQLIINDDAELAARLGVGLHLGQEDGSLAVARALLGRQAVIGATCHAQLPLAEQ
AARDGASYVAFGRFFQSQTKPGAPAADPQLLREARTRIGLPIVAIGGITPETAPSLLAEG
VQMIAVVHALFAADSPAEVERRARAFSQLFNTP