Protein Info for PGA1_c05420 in Phaeobacter inhibens DSM 17395

Updated annotation (from data): glucokinase (EC 2.7.1.2)
Rationale: Important for the utilization of glucose, trehalose, and cellobiose; trehalose and cellobiose are cleaved to glucose
Original annotation: glucokinase Glk

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02685: Glucokinase
  • amino acids 8 to 309 (302 residues), 151.5 bits, E=2.9e-48
• PF00480: ROK
  • amino acids 11 to 308 (298 residues), 29.2 bits, E=7e-11

Best Hits

KEGG orthology group: K00845, glucokinase [EC: 2.7.1.2] (inferred from 52% identity to sil:SPO0864)

Predicted SEED Role

"Glucokinase (EC 2.7.1.2)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis (EC 2.7.1.2)

MetaCyc Pathways

• Bifidobacterium shunt (12/15 steps found)
• glycolysis III (from glucose) (9/11 steps found)
• homolactic fermentation (9/12 steps found)
• sucrose degradation III (sucrose invertase) (3/4 steps found)
• heterolactic fermentation (13/18 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
• GDP-α-D-glucose biosynthesis (2/3 steps found)
• trehalose degradation V (2/3 steps found)
• UDP-N-acetyl-D-glucosamine biosynthesis II (4/6 steps found)
• trehalose degradation I (low osmolarity) (1/2 steps found)
• trehalose degradation II (cytosolic) (1/2 steps found)
• glucose and glucose-1-phosphate degradation (3/5 steps found)
• trehalose degradation IV (1/3 steps found)
• chitin biosynthesis (5/9 steps found)
• sucrose biosynthesis II (4/8 steps found)
• glycogen degradation II (2/6 steps found)
• 1,3-propanediol biosynthesis (engineered) (4/9 steps found)
• glycogen degradation I (3/8 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Starch and sucrose metabolism
• Streptomycin biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.2

Sequence Analysis Tools

See I7DXX1 at UniProt or InterPro

Protein Sequence (316 amino acids)

>PGA1_c05420 glucokinase (EC 2.7.1.2) (Phaeobacter inhibens DSM 17395)
MGSDMTVLVGDVGGSNTRLALAGPEIGVTALQSFANDSFSSLDDVLAAYCAQPDLPPLAG
ACIAVAGPVYGNEYQLTNRNWQGSAADLAQQLQLGAGARVDVINDLAALGHSLLALIPGQ
LSSLRAGHQRGTQALVAGIGTGFNVSLSVDGHTAEAEMGHTSLSAPVTRGLTDLLGDRAG
EFATNEDLFSGRGLVRYHQALHGIAAEGGAQIVADYLADGDSPAAKTVTSWARLLGDFAR
ELVPTYMPGQGIFFAGSVARGILGTAACEVFLNSFLQPATGVQSRCETTPLWLITDDAAG
VSGAARFALERAGRKS