Protein Info for HP15_513 in Marinobacter adhaerens HP15

Annotation: lipoprotein signal peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 174 transmembrane" amino acids 16 to 39 (24 residues), see Phobius details amino acids 47 to 65 (19 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 99 to 117 (19 residues), see Phobius details amino acids 137 to 157 (21 residues), see Phobius details TIGR00077: signal peptidase II" amino acids 8 to 161 (154 residues), 144.2 bits, see alignment E=1.7e-46 PF01252: Peptidase_A8" amino acids 19 to 160 (142 residues), 154.4 bits, see alignment E=1.2e-49

Best Hits

Swiss-Prot: 59% identical to LSPA_PSEA7: Lipoprotein signal peptidase (lspA) from Pseudomonas aeruginosa (strain PA7)

KEGG orthology group: K03101, signal peptidase II [EC: 3.4.23.36] (inferred from 86% identity to maq:Maqu_0863)

Predicted SEED Role

"Lipoprotein signal peptidase (EC 3.4.23.36)" in subsystem Sex pheromones in Enterococcus faecalis and other Firmicutes or Signal peptidase (EC 3.4.23.36)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.4.23.36

Use Curated BLAST to search for 3.4.23.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PNF9 at UniProt or InterPro

Protein Sequence (174 amino acids)

>HP15_513 lipoprotein signal peptidase (Marinobacter adhaerens HP15)
MDATMTEQVTGSKLKWLWLAVLVIALDLGTKAMATAILTYGDPVPVIPMFNLTLLHNTGA
AFSFLAEAAGWQRWFFVTLALVVSVVLIYWLKNLQRHETWTAIAIVLILGGALGNVYDRV
VHGYVVDFLHFYWQDWHFPAFNLADTAITIGAAMMILDMFRKPADSDGDAQRSE