Protein Info for HP15_510 in Marinobacter adhaerens HP15

Annotation: integral membrane protein MviN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 497 transmembrane" amino acids 15 to 33 (19 residues), see Phobius details amino acids 75 to 102 (28 residues), see Phobius details amino acids 121 to 140 (20 residues), see Phobius details amino acids 147 to 168 (22 residues), see Phobius details amino acids 176 to 197 (22 residues), see Phobius details amino acids 218 to 242 (25 residues), see Phobius details amino acids 262 to 280 (19 residues), see Phobius details amino acids 301 to 324 (24 residues), see Phobius details amino acids 343 to 363 (21 residues), see Phobius details amino acids 372 to 391 (20 residues), see Phobius details amino acids 397 to 416 (20 residues), see Phobius details amino acids 432 to 452 (21 residues), see Phobius details amino acids 470 to 489 (20 residues), see Phobius details TIGR01695: murein biosynthesis integral membrane protein MurJ" amino acids 1 to 490 (490 residues), 487.5 bits, see alignment E=2.5e-150 PF03023: MurJ" amino acids 16 to 452 (437 residues), 489.7 bits, see alignment E=3.8e-151

Best Hits

Swiss-Prot: 51% identical to MURJ_SALTY: Probable lipid II flippase MurJ (murJ) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03980, virulence factor (inferred from 90% identity to maq:Maqu_0860)

MetaCyc: 50% identical to lipid II flippase MurJ (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-286

Predicted SEED Role

"Proposed peptidoglycan lipid II flippase MurJ" in subsystem ZZ gjo need homes

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PNF6 at UniProt or InterPro

Protein Sequence (497 amino acids)

>HP15_510 integral membrane protein MviN (Marinobacter adhaerens HP15)
MTMLSRVLGLVRDMVIARYFGAGAGADAFFVAFKIPNFLRRLFAEGAFSQAFVPVLSSYR
ENQSLSDVQRLVNAVAGSLGLVLLGVTLVAILGAPVLTAVFAPGFLDDEVKFALTSDMLR
ITFPYLLLISLTAFAGGILNSYDRFAVPAFTPVLLNLAMIAAAIWLTPLMDEPVMALAWG
VFIAGALQLFFQLPFLMRLGLLPRPRVDYRHEGVSRILKLMAPALFGVSVSQINLLLDTV
LASFLQTGSVSWLYYSDRLSELPLGVFGIAIATVILPSLSRKHAAASADQFAATLDWAVR
AVLLIGLPAALALALLAEPLIATLFHYGAVTDRDVAMSAQSLRAYSAGLLAFMLIKVLAP
GFFAREDTKTPVKIGIIAMVANMVFNLILIFPLAHAGLALATSISAWLNGYLLWRGLRKE
GAWQSQPGWPRFLLQLLFANGALAAVIVWLNAPVSVWLANGGYQRAADMAMLVAAGVAVY
FVALALAGVRVRHFRHR