Protein Info for HP15_503 in Marinobacter adhaerens HP15

Annotation: glutathione S-transferase protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13409: GST_N_2
  • amino acids 62 to 157 (96 residues), 50 bits, E=7.8e-17
• PF00043: GST_C
  • amino acids 201 to 279 (79 residues), 28.3 bits, E=3.5e-10
• PF13410: GST_C_2
  • amino acids 205 to 276 (72 residues), 62.1 bits, E=9.1e-21
• PF14497: GST_C_3
  • amino acids 209 to 286 (78 residues), 26.7 bits, E=1.1e-09

Best Hits

Swiss-Prot: 57% identical to PCPF_SPHCR: Glutathionyl-hydroquinone reductase PcpF (pcpF) from Sphingobium chlorophenolicum

KEGG orthology group: K07393, putative glutathione S-transferase (inferred from 82% identity to maq:Maqu_0853)

Predicted SEED Role

"Glutathione S-transferase, omega (EC 2.5.1.18)" in subsystem Glutathione: Non-redox reactions (EC 2.5.1.18)

MetaCyc Pathways

• 4-hydroxy-2-nonenal detoxification (1/4 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• pentachlorophenol degradation (3/10 steps found)
• gliotoxin biosynthesis (1/9 steps found)
• glutathione-mediated detoxification II (1/9 steps found)
• indole glucosinolate activation (intact plant cell) (3/12 steps found)
• camalexin biosynthesis (2/12 steps found)

KEGG Metabolic Maps

• Drug metabolism - cytochrome P450
• Glutathione metabolism
• Metabolism of xenobiotics by cytochrome P450

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Sequence Analysis Tools

See E4PNE9 at UniProt or InterPro

Protein Sequence (328 amino acids)

>HP15_503 glutathione S-transferase protein (Marinobacter adhaerens HP15)
MGLLIDGKWHDKWYDTDKTGGKFEREAARFRNWVTADGSPGPDGEGGFKAESGRYHLYVS
MACPWAHRTLIFRKLKGLEKHISVSVVHPDMVENGWEFRPDSEQHRDHLHGFRFMHQVYT
KAAPEYSGRVTVPTLWDKKKETIASNESAEIIRMFNSAFDGLEGVRTDLDFYPGELQEEI
DTVNARVYDTVNNGVYKAGFATAQDKYEEAYNALFDSLDWLEERLSSQRYLVGGRLTEAD
WRLFTTLIRFDAVYYSHFKCNRQRISDFPALSAYVRDLYQVPGVAETVDIDQIKRHYYVS
QRTINPTQIVPVGPKLDFDSPHGRESLS