Protein Info for Psest_0515 in Pseudomonas stutzeri RCH2

Annotation: rare lipoprotein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF03330: DPBB_1" amino acids 96 to 185 (90 residues), 90.2 bits, see alignment E=8.6e-30 TIGR00413: rare lipoprotein A" amino acids 98 to 190 (93 residues), 143.3 bits, see alignment E=5.1e-46 PF05036: SPOR" amino acids 253 to 317 (65 residues), 43.5 bits, see alignment E=3.3e-15

Best Hits

Swiss-Prot: 71% identical to RLPA_PSEAB: Endolytic peptidoglycan transglycosylase RlpA (rlpA) from Pseudomonas aeruginosa (strain UCBPP-PA14)

KEGG orthology group: K03642, rare lipoprotein A (inferred from 94% identity to psa:PST_3778)

Predicted SEED Role

"Rare lipoprotein A precursor" in subsystem Peptidoglycan Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GH81 at UniProt or InterPro

Protein Sequence (330 amino acids)

>Psest_0515 rare lipoprotein A (Pseudomonas stutzeri RCH2)
MSAIWTRLVVLGVTGLLLASCSSTPAPSSTQSKPAGSSGPGDYARPHKDGAPWWDVDVSQ
IQDAVPMPHYGPYKANPYTVLGKTYFPISDGRRYSATGTASWYGTKFHGQPTANGEKYDL
YGMSAAHKTLPLPTYVKVTNLDNGRTVTLRVNDRGPFYSDRIIDLSFAAAKKLGFAESGT
ARVKVEGIDPEQWWAQQGRPVPSMMAQPQMAAAKPASSIAQPIEQYTPPPQQHAAATVPL
EIDAKKNASPAASGLFLQVGAFANPDAAQLLKDKLSGVVSAPVFISSVVHNQQTLHRVRL
GPIDTPDEAMQLEQSVRLANLGQPRRVAAD