Protein Info for HP15_496 in Marinobacter adhaerens HP15

Annotation: thiamine-monophosphate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 TIGR01379: thiamine-phosphate kinase" amino acids 2 to 314 (313 residues), 306.3 bits, see alignment E=1.1e-95 PF00586: AIRS" amino acids 28 to 138 (111 residues), 93.9 bits, see alignment E=8.6e-31 PF02769: AIRS_C" amino acids 150 to 297 (148 residues), 30.8 bits, see alignment E=3.3e-11

Best Hits

KEGG orthology group: K00946, thiamine-monophosphate kinase [EC: 2.7.4.16] (inferred from 63% identity to maq:Maqu_0847)

Predicted SEED Role

"Thiamine-monophosphate kinase (EC 2.7.4.16)" in subsystem Thiamin biosynthesis (EC 2.7.4.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.4.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PNE2 at UniProt or InterPro

Protein Sequence (318 amino acids)

>HP15_496 thiamine-monophosphate kinase (Marinobacter adhaerens HP15)
MGEFELIRRYFLPLAGRQESGSLILGPGDDCAIQRIPAGRDLVFSVDALVEGVHFPRNYR
PDYLGWRALAAAASDLAAMGADPECFTLALTLPAVDKQWLEDFSMGLRKASEAFGLELAG
GDTTSGPLTLSLQVHGTVEQGAGIRRSGARPGDLIAVSGTLGDAGAALDYLSEPAPSADM
LAVLERYHHPWPRLDLAGAIRQYATAAVDISDGLLADLGHILSASGVGARIESARMPLSP
ALIRLKGEKALDCALRSGDDYELCLCFSRENWERAPESLKRQLTVIGFVEAEPGLYLDGV
DCSLEAVPAGFDHFRSEL