Protein Info for PGA1_c05190 in Phaeobacter inhibens DSM 17395

Annotation: ABC transporter, inner membrane component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 65 to 87 (23 residues), see Phobius details amino acids 99 to 119 (21 residues), see Phobius details amino acids 130 to 152 (23 residues), see Phobius details amino acids 174 to 200 (27 residues), see Phobius details amino acids 231 to 252 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 80 to 259 (180 residues), 38.5 bits, see alignment E=5.4e-14

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 97% identity to sit:TM1040_2420)

Predicted SEED Role

"Inositol transport system permease protein" in subsystem Inositol catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DMD0 at UniProt or InterPro

Protein Sequence (265 amino acids)

>PGA1_c05190 ABC transporter, inner membrane component (Phaeobacter inhibens DSM 17395)
MQKRTIVPIVYILFLMLPIYWLVAMSFKTTNEILSGFSLFPQTFTLENYATIFTDPSWYW
GYINSIIYVSINTVISVAVALPAAYAFSRYRFLGDKQLFFWLLTNRMAPAAVFALPFFQL
YSAVGLFDTHLAVALAHCLFNIPLAVWILEGFMGGIPKELDETAYVDGYSFPRFFATIFI
PSIKAGVGVAAFFCFMFSWVELLLAKTLTAVAAKPIAATMTKTASSAGYELGLLAAAGTL
TIIPGAIVIYFVRNYIAKGFAMGRV