Protein Info for PGA1_c05170 in Phaeobacter inhibens DSM 17395

Annotation: penicillinase repressor blaI/mecI-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 131 PF03965: Penicillinase_R" amino acids 10 to 123 (114 residues), 98.5 bits, see alignment E=1.7e-32

Best Hits

KEGG orthology group: K07737, putative transcriptional regulator (inferred from 85% identity to sit:TM1040_2422)

Predicted SEED Role

"Transcriptional regulator, MecI family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DXR1 at UniProt or InterPro

Protein Sequence (131 amino acids)

>PGA1_c05170 penicillinase repressor blaI/mecI-like protein (Phaeobacter inhibens DSM 17395)
MRKKQDNPLLTEVELEFMTVVWETGGGTVRDILAELNKRQERAYTSVATVLKIMEQKGFL
TSERADRSLVYRPAVPKADYQKTTLKNLSSKLFNGAPAALVARLVDDEDVTDEMLVEIRA
LLNERLGDDER