Protein Info for Psest_0508 in Pseudomonas stutzeri RCH2

Annotation: gamma-glutamyl phosphate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 PF00171: Aldedh" amino acids 14 to 285 (272 residues), 54.8 bits, see alignment E=3.3e-19 amino acids 313 to 377 (65 residues), 25.3 bits, see alignment E=2.9e-10 TIGR00407: glutamate-5-semialdehyde dehydrogenase" amino acids 16 to 410 (395 residues), 505.5 bits, see alignment E=4.7e-156

Best Hits

Swiss-Prot: 97% identical to PROA_PSEU5: Gamma-glutamyl phosphate reductase (proA) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K00147, glutamate-5-semialdehyde dehydrogenase [EC: 1.2.1.41] (inferred from 97% identity to psa:PST_3785)

Predicted SEED Role

"Gamma-glutamyl phosphate reductase (EC 1.2.1.41)" in subsystem Proline Synthesis (EC 1.2.1.41)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GI77 at UniProt or InterPro

Protein Sequence (421 amino acids)

>Psest_0508 gamma-glutamyl phosphate reductase (Pseudomonas stutzeri RCH2)
MTESVLDYMTRLGRAAREASRVLARASTAQKNRALQAAAAALDAARDELVRANELDLAGG
RANGLDAAMLDRLALTPKVIDGMIEGLRQVATLPDPIGAIRDMRYMPSGIQVGKMRVPLG
VVGIIYESRPNVTIDAASLCLKSGNATILRGGSEAIHSNQAIARCIQLGLAEAGLPAAAV
QVVETTDRAAVGALISMPEFVDVIVPRGGKGLIERISRDARVPVIKHLDGICHVYIDVAA
DVDKAIRIADNAKTQRFAPCNTMETLLVHPGIAEQVLPPLAAIYREKSVELRGCPRTRAL
LGSDVLEASEEDWSTEYNAPILSIRLVDSLDAAIEHINRYGSQHTDAIVTENFTDARRFL
TEVDSASVMINASTRFADGFEYGLGAEIGISTDKLHARGPVGLEGLTSEKYVVFGDGHVR
T