Protein Info for PGA1_c05150 in Phaeobacter inhibens DSM 17395

Annotation: chemoreceptor McpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 760 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details transmembrane" amino acids 348 to 369 (22 residues), see Phobius details PF00672: HAMP" amino acids 368 to 418 (51 residues), 41.5 bits, see alignment 1.4e-14 PF00015: MCPsignal" amino acids 548 to 700 (153 residues), 155.9 bits, see alignment E=9.4e-50

Best Hits

KEGG orthology group: None (inferred from 58% identity to sit:TM1040_0433)

Predicted SEED Role

"FIG00918265: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EU47 at UniProt or InterPro

Protein Sequence (760 amino acids)

>PGA1_c05150 chemoreceptor McpA (Phaeobacter inhibens DSM 17395)
MRVMPKAPKLSLKLKLPLIMVALTATFLVTVSFLVYSMAEKSIRDFVYASKETTARSGEQ
ALTFMMEAARRDLSINASQPTVFRAINNFDRVYKMIEEEPVGFLRRHYIEENPNAANERH
LLSDPGDGSYYSQSHATYHPTFLQSLQVNGYEDLYLLNASGQLLYSVKKREDFIQQFGSG
DNADSGLGQVFNAALNVEAGQVVTADFAAYTPGGGAAGAFMGVPVFNKKKEVIGVMAVQI
SSASVVTALTSNMKVDGHQNIFLVGRDGIARSPSVIEGQFATGDQLPDSAEIKAASAGEA
GMFEGSTSVSGEQVIALVNPLNINGFDWSLVLQTDEQEAFAEVTEIRLVAMLMIGVSVLI
AIVVSFVAARHVTRPILALREATNALAEEDYASEISGRDRGDELGDLARSLDTFRDKLLV
ADEAADREEEAAKQTAAVVEEMSGALAELQRGNLACDIGQPFVEHYEILRENFNRSLVNL
RDSLAEVVDAAHNVDKFSEEQRASAEEMAHRTESQAGTLEETASALQDLTNSIRETADRA
GQVDETMRGTRNEAEHSNHIVTSAVQAMDQIQEASQQISQIINMIDDIAFQTNLLALNAG
VEAARAGEAGAGFAVVASEVRALAMRASKAAGEIKGLTTASEEHVANGVAMVGRAGDALS
GIIDKVTNVSDLITEIAEGVQKQSKGLENINNAVGRLDSTTQQNAAMSEEASAASQLLQN
EAQALTGVVSRFQLGNGAAHDNVDDWGTVDDAGKGAHSYG