Protein Info for Psest_0501 in Pseudomonas stutzeri RCH2

Annotation: Predicted nucleoside-diphosphate-sugar epimerases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 PF13460: NAD_binding_10" amino acids 12 to 152 (141 residues), 28.8 bits, see alignment E=1.6e-10 PF08732: HIM1" amino acids 58 to 160 (103 residues), 32.2 bits, see alignment E=1.2e-11

Best Hits

Swiss-Prot: 47% identical to YRAR_ECOLI: Putative NAD(P)-binding protein YraR (yraR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 97% identity to psa:PST_3792)

Predicted SEED Role

"Nucleoside-diphosphate-sugar epimerases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GEF5 at UniProt or InterPro

Protein Sequence (213 amino acids)

>Psest_0501 Predicted nucleoside-diphosphate-sugar epimerases (Pseudomonas stutzeri RCH2)
MYLTPQRILLAGATGLTGEHLLDRLLNEPTVERVLAPTRRPLAAHQRLENPVGELLALLP
TLSGAIDTAFCCLGSTLKQAGGQEAFRAIDHDLVLAFARRAKEMGARHLLVISSLGANPD
SSIFYLKVKGEMEAALQQQDWPQLTIARPSQLIGPRLEPRLSERIAAPLSQLLPGKYHGI
ETCTLARALWRLALEEGDGVRIVESDELRKLGK