Protein Info for PGA1_c05070 in Phaeobacter inhibens DSM 17395

Annotation: putative pyridoxal-phosphate-dependent aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 54% identical to ERBS_SACEN: Erythromycin biosynthesis sensory transduction protein EryC1 (eryC1) from Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)

KEGG orthology group: None (inferred from 62% identity to tel:tlr1344)

MetaCyc: 54% identical to dTDP-3-oxo-3,4,6-trideoxy-alpha-D-glucopyranose transaminase monomer (Saccharopolyspora erythraea NRRL 2338)
RXN-12768 [EC: 2.6.1.106]

Predicted SEED Role

"Aminotransferase"

MetaCyc Pathways

dTDP-D-desosamine biosynthesis (3/6 steps found)
superpathway of erythromycin biosynthesis (3/19 steps found)
superpathway of megalomicin A biosynthesis (4/22 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.106

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DXQ4 at UniProt or InterPro

Protein Sequence (365 amino acids)

>PGA1_c05070 putative pyridoxal-phosphate-dependent aminotransferase (Phaeobacter inhibens DSM 17395)
MQVPFLDLKAAYDELAEHSEPKMLESLRSGWYILGPEVSQFEQDFARYCEVSHALGVANG
LDALRLALVALDIGPGDRVLVPSNTYIATWLAVSQCGAIPVPVEPDPVTHNITAEGIRAA
MVPGAKAVIPVHLYGQPADMTAIMAAARDLGLKVIEDAAQAHGACWDGRRIGGAGDIVCW
SFYPGKNLGALGDGGAVTTNCDTLAERLMLLRNYGSREKYRNEVAGFNSRLDPVQAAFLS
VKLAVLDDWNTRRGAIAARYLSELDGLDLTLPHVATKADPVWHLFVVRHPERDRLAADLA
KVGIQTLVHYPIPPHAQAAYHDMGLTDEALPLATTLAREVLSLPIGPHLSTAQIDHVIKS
LRQLV