Protein Info for Psest_0497 in Pseudomonas stutzeri RCH2

Annotation: Flagellar motor protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 transmembrane" amino acids 23 to 45 (23 residues), see Phobius details PF13677: MotB_plug" amino acids 11 to 63 (53 residues), 68.6 bits, see alignment 2.8e-23 PF00691: OmpA" amino acids 164 to 254 (91 residues), 47 bits, see alignment E=2.7e-16

Best Hits

KEGG orthology group: K02557, chemotaxis protein MotB (inferred from 90% identity to psa:PST_3796)

Predicted SEED Role

"Flagellar motor rotation protein MotB" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GIH0 at UniProt or InterPro

Protein Sequence (326 amino acids)

>Psest_0497 Flagellar motor protein (Pseudomonas stutzeri RCH2)
MDNTQPIIVKRVKKVAGGHHGGAWKIAFADFATAMMAFFLVMWLMSSATPEQKKLISGYF
QDPIGFTESASPHVIDLGGTPTPSPDRTLNPELEPAQSEAQIDSSQVETFAEQLERERLE
LLLQELQNKVDENPELQKFKDQILFEITQDGLRIQIMDAENRPMFALGSAQLQPYFEDIL
LALVDTIAAVPNKISISGHTDAKPYSGRGDFGNWELSSGRANAARRTLVTGGYPEEQIAR
VVGYASSALFDRNDPFNPVNRRIDILVLTKKAQRSIEGEQSDAAEGAVPAQGAAPAVQEP
LQAPQLRERLNIFEDGVLQFSQPGAR