Protein Info for PGA1_c05010 in Phaeobacter inhibens DSM 17395

Annotation: putative dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 PF00355: Rieske" amino acids 42 to 125 (84 residues), 55.4 bits, see alignment E=4.7e-19 PF00848: Ring_hydroxyl_A" amino acids 183 to 400 (218 residues), 117.2 bits, see alignment E=1e-37

Best Hits

KEGG orthology group: K00479, Rieske 2Fe-2S family protein (inferred from 72% identity to sit:TM1040_3219)

MetaCyc: 66% identical to stachydrine N-demethylase oxygenase subunit (Sinorhizobium meliloti 1021)
R501-RXN [EC: 1.14.13.247]

Predicted SEED Role

"Benzoate 1,2-dioxygenase (EC 1.14.12.10)" (EC 1.14.12.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.12.10 or 1.14.13.247

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EWM8 at UniProt or InterPro

Protein Sequence (412 amino acids)

>PGA1_c05010 putative dioxygenase (Phaeobacter inhibens DSM 17395)
MLHDSEILAKLMGRQKNYSLEQAFYNDPGVFDLDMREVFYREWLFAIPACELPKSGSFVT
HQVGAYNVIIVRGVDGLVRAFHNACRHRGSVVCKAKKGNTPKLVCPYHQWTYELDGTLLW
ARDMGPDFNPSQHGLKTVHCRDLEGLIYICLADEAPDFEVFADLVRPYLAPHDLGNAKVA
FESSIVENGNWKLVWENNRECYHCAGNHPSLCRSYPEDPAVTGVSEDGVPPKVQDHFDRI
EAVGVAARFQLDQNRGQFRVARMPLLDGAVSFTMDGKAAVSKNLGKIPFADAGTLLQFHY
PSTWNHFLPDHSIVFCINPVSPTETEVTTKWLVHKDAEEGVDYDLKRLTEVWIATNDEDR
IVVEDNQQGINSPVYTPGPYSPSQESGVIQFGDWYASQLTRRLTGRNLIAAE