Protein Info for HP15_478 in Marinobacter adhaerens HP15

Annotation: type 4 fimbrial biogenesis protein PilQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 688 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF11741: AMIN" amino acids 156 to 250 (95 residues), 51.3 bits, see alignment E=2.1e-17 TIGR02515: type IV pilus secretin PilQ" amino acids 271 to 683 (413 residues), 513.4 bits, see alignment E=2.7e-158 PF07660: STN" amino acids 297 to 344 (48 residues), 37.8 bits, see alignment 2.7e-13 PF03958: Secretin_N" amino acids 371 to 433 (63 residues), 43 bits, see alignment E=8.8e-15 PF00263: Secretin" amino acids 528 to 683 (156 residues), 176.1 bits, see alignment E=9.3e-56

Best Hits

KEGG orthology group: K02666, type IV pilus assembly protein PilQ (inferred from 86% identity to maq:Maqu_0830)

Predicted SEED Role

"Type IV pilus biogenesis protein PilQ" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PMW4 at UniProt or InterPro

Protein Sequence (688 amino acids)

>HP15_478 type 4 fimbrial biogenesis protein PilQ (Marinobacter adhaerens HP15)
MFRKLNVYVSVIAFGLLSGLANAVTLEDVSFSSLPGERLEVTLQFDGAPPEPSGYTIERP
ARIAVDLRDTTSGLDSRSVPLGSGNAQSMTVVETKDRTRLIFNLVELVPYDTVRSGNSLI
MTIGGQSEGVVASPSTSVSQSSGTTSAAPSDALAGVDFRRGKDGEGRVLVDLGSSSTPVD
LTERAGRIRLTMDGISVPADLRRRLDVTDFATPVTRIDTFVEDGNAVVEISPEGNYDYIA
YQSGSQFTVSVEELSQEEAESRREEKFPYTGDKLSLNFQDIEVRSVLQLIADFTGLNLVA
SDTVGGSITLRLQNVPWDQALDLILKTKGLDKRQIGNVLLVAPADEIAAREKLELETSKQ
IAELAPVRLDIVQVNYAKAADIVALIKEDEELISDRGFVSSDVRTNTISVRETAEKLEEI
RRLVSTWDVPVRQVSIEARIVRAQTNVAENLGVRWGGAAYDVSGDNVFTVGGSQGSLQEA
RDAAAGNSNTISFPGALAVDLGVSGEGTSSFAIGWGSDNFLVDLELSALESDGQAEVVSQ
PRVVTADRQTASIKSGEEIPYQEATSSGATNIEFKEAVLSLEVTPQITPDDKIIMDLVVN
QDSRGEVTAGIPSINTNSVTTQVLVGNGETVVLGGIFQSEVATQTTKTPFLGDIPYLGRI
FKRTEHLDERSELLIFITPKIIKNDLLR