Protein Info for Psest_0493 in Pseudomonas stutzeri RCH2

Annotation: phosphatidylserine decarboxylase precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 transmembrane" amino acids 196 to 217 (22 residues), see Phobius details TIGR00163: phosphatidylserine decarboxylase" amino acids 49 to 283 (235 residues), 267.6 bits, see alignment E=3.7e-84 PF02666: PS_Dcarbxylase" amino acids 63 to 282 (220 residues), 212 bits, see alignment E=3.6e-67

Best Hits

Swiss-Prot: 95% identical to PSD_PSEU5: Phosphatidylserine decarboxylase proenzyme (psd) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K01613, phosphatidylserine decarboxylase [EC: 4.1.1.65] (inferred from 95% identity to psa:PST_3800)

Predicted SEED Role

"Phosphatidylserine decarboxylase (EC 4.1.1.65)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 4.1.1.65)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.65

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GI69 at UniProt or InterPro

Protein Sequence (299 amino acids)

>Psest_0493 phosphatidylserine decarboxylase precursor (Pseudomonas stutzeri RCH2)
MKDRLFVISQYVLPHHLISRLAGCLAECRLPWVKNTFIKWFVRHFQVDMREAQTEEPTAY
EHFNAFFTRALKDGARPLDTTPGAILNPCDGAISQLGQIEQGRIFQAKGHSFSAMELLGG
DHERAAPFMGGAFATVYLSPKDYHRVHMPVSGTLREMVYVPGRIFSVNTVTAQGVPELFA
RNERVVCLFDTEHGPMAMVLVGAMIVASIETVWAGLVTPPKRTLKTVRYDEAARAPIHLE
KGAEMGRFKLGSTVILLFGPDQVRWAEQLGPLSPVCMGEALGQAEAISTSALIEPTELS