Protein Info for Psest_0491 in Pseudomonas stutzeri RCH2

Annotation: PAS domain S-box/diguanylate cyclase (GGDEF) domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 688 TIGR00229: PAS domain S-box protein" amino acids 140 to 251 (112 residues), 36.7 bits, see alignment E=4e-13 PF00989: PAS" amino acids 147 to 249 (103 residues), 32 bits, see alignment E=2.1e-11 PF13188: PAS_8" amino acids 148 to 194 (47 residues), 21.5 bits, see alignment 3.4e-08 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 264 to 410 (147 residues), 48.2 bits, see alignment E=9.5e-17 PF00990: GGDEF" amino acids 267 to 414 (148 residues), 64.8 bits, see alignment E=1.7e-21 PF00563: EAL" amino acids 442 to 674 (233 residues), 185.4 bits, see alignment E=2.3e-58

Best Hits

KEGG orthology group: None (inferred from 92% identity to psa:PST_3802)

Predicted SEED Role

"FOG: PAS/PAC domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GEE6 at UniProt or InterPro

Protein Sequence (688 amino acids)

>Psest_0491 PAS domain S-box/diguanylate cyclase (GGDEF) domain (Pseudomonas stutzeri RCH2)
MALQKKTIRLLILEDSQNEAERLVSLFRNAGQATRVHRLTSSDDLAEALKQTWDLLINAP
QSENLDPSEAIAAIRRQAKDIPIIQLTAGNDAEAITDALMLGAQDALPQGEDEWLLLVAN
RELANLEERRARRSAEVALREAEKRCQLLLDSSVDAIAYVHDGMHIYANRAYLELFGYAD
VEDLEGMPMIDLISGSDQSTFKAFLKNYQTLEGSAELACGGVRADGETLKTRMHFSPAAY
DGEPCIQVVIRAENDSAELQKLREISSQDPVTGLLNRNSFLEVMDAAVERAVNAGQTASL
AYIRIDRFAALQAEIGLTDSDQLLNQLAILLRGHFPAETQLARFADDVFTVLQPGVIPQL
AEPELRKLLSKVEGHLLDVGGRTVQTTLSIGVAGLDEKTAKAQDAIERAHRCADELSDGN
ALKIYDPADELAAAANRGDIAAMLRQALENNSFRLLFQPIISLRGDSFEHYEVLLRLLDP
QGAEVPPNEFLSTAADVGLSAKIDRWVILNSIKLLAEHRAKGHRTRLFLHLCAASLQDPS
LLPWLGVVLKASRLPGDSLVFEFGEADAVAYLKPAKALAQGLRGLGCHIGLAQFGCVLNP
FNTLKHLDAGFIKVDGSYTQDLTRQENQEALKTLLADLHEQQKQSIVPFVESATVLATLW
QAGVSYIQGHYLQGPSQSMDYDFSSDEE