Protein Info for HP15_466 in Marinobacter adhaerens HP15

Annotation: ATP-dependent protease peptidase subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 PF00227: Proteasome" amino acids 2 to 171 (170 residues), 76.7 bits, see alignment E=9.6e-26 TIGR03692: ATP-dependent protease HslVU, peptidase subunit" amino acids 2 to 171 (170 residues), 287 bits, see alignment E=2.1e-90

Best Hits

Swiss-Prot: 92% identical to HSLV_MARHV: ATP-dependent protease subunit HslV (hslV) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K01419, ATP-dependent HslUV protease, peptidase subunit HslV [EC: 3.4.25.2] (inferred from 92% identity to maq:Maqu_0818)

MetaCyc: 78% identical to peptidase component of the HslVU protease (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP-dependent protease HslV (EC 3.4.25.-)" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent (EC 3.4.25.-)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.25.- or 3.4.25.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PMV2 at UniProt or InterPro

Protein Sequence (176 amino acids)

>HP15_466 ATP-dependent protease peptidase subunit (Marinobacter adhaerens HP15)
MTTILSVRRDDEVAMGGDGQVSLGNTVMKGNARKVRRLYNGQVIAGFAGGTADAFTLFER
FEAQLEKHQGNLTRAAVELAKDWRTDRALRRLEALLAVADKTASLIITGNGDVIEPEQGL
IAIGSGGPFAQASARALLENTDLSAHEIVEKGLDIAADICIYTNHNRTLEVLSKND