Protein Info for Psest_0481 in Pseudomonas stutzeri RCH2

Annotation: Predicted phosphohydrolases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 60% identical to CPDA_PSEAI: 3',5'-cyclic adenosine monophosphate phosphodiesterase CpdA (cpdA) from Pseudomonas aeruginosa

KEGG orthology group: K03651, Icc protein (inferred from 89% identity to psa:PST_3812)

Predicted SEED Role

"3',5'-cyclic-nucleotide phosphodiesterase (EC 3.1.4.17)" in subsystem cAMP signaling in bacteria (EC 3.1.4.17)

KEGG Metabolic Maps

Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.4.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GED6 at UniProt or InterPro

Protein Sequence (271 amino acids)

>Psest_0481 Predicted phosphohydrolases (Pseudomonas stutzeri RCH2)
MPGATLTAVEDSVLLVQLTDSHLFAEADGKLLGMNTCDSLERVIELAIDEQPRIDLVLAT
GDLSQDGSVASYQRFRRLAERIEAPARWCPGNHDELAAMREASRGSALMEPVLEIGGWRV
VMLDTLVAGSVYGMLRSDQLDLLDQALSEAPAHHHLICLHHHPVSIGSRWMDTIGLRNPD
ALFEVLDRHSNVRALLWGHIHQEFDHWRNDLRLLASPSTGVQFTPQSEDFQVDSAAPGYR
WLRLYADGRLDTEVSRVSGIEFEIDYSVKGY