Protein Info for HP15_460 in Marinobacter adhaerens HP15

Annotation: SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF17785: PUA_3
  • amino acids 9 to 75 (67 residues), 57 bits, E=5.3e-19
• PF10672: Methyltrans_SAM
  • amino acids 172 to 305 (134 residues), 67.3 bits, E=5.4e-22
• PF02475: TRM5-TYW2_MTfase
  • amino acids 188 to 300 (113 residues), 29.4 bits, E=3.1e-10
• PF03602: Cons_hypoth95
  • amino acids 218 to 303 (86 residues), 53.4 bits, E=1.1e-17
• PF05175: MTS
  • amino acids 223 to 336 (114 residues), 30.2 bits, E=1.3e-10
• PF13847: Methyltransf_31
  • amino acids 224 to 350 (127 residues), 39.7 bits, E=1.7e-13
• PF09445: Methyltransf_15
  • amino acids 225 to 352 (128 residues), 40.2 bits, E=1.1e-13
• PF13649: Methyltransf_25
  • amino acids 227 to 323 (97 residues), 31.1 bits, E=1.2e-10

Best Hits

KEGG orthology group: K06969, ribosomal RNA large subunit methyltransferase I [EC: 2.1.1.-] (inferred from 86% identity to maq:Maqu_0812)

Predicted SEED Role

"LSU m5C1962 methyltransferase RlmI" in subsystem Ribosome biogenesis bacterial

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

See E4PMU6 at UniProt or InterPro

Protein Sequence (401 amino acids)

>HP15_460 SAM-dependent methyltransferase (Marinobacter adhaerens HP15)
MVFMNFPVLYLRKGAERRLRAGHLWVYSNEVDTRRSPLTEFEAGVQAELRASNDKPLGTV
FVNPHALICGRLISRDPGHGMTPQRLTQRMEAALALRERLFDKPFYRWVFGDSDGLSGLV
IDRFDSTVVVQISTAGMEAMKEAVVRAVQRLVHPEAIILKNDGKMRKVEGLDTYVEQAHG
AAVSLLEVEENGVRFEVPLEGGQKTGWFYDHRMNRARLQAYAPGKRVLDVFSYVGGWGIQ
AACAGATQVTCVDSSAGAIDSVHHNARLNGLDNVETIEGDAFEALKALADEKEKFDVVVL
DPPALIPRRRDQKAGEEAYARLNQLGLRLLERDGILVSASCSMHLSQEKLVDIIRGSGRK
IDRFVQLLEQGHQAPDHPVIPGIPETDYIKSCFVRSLTGFF