Protein Info for Psest_0468 in Pseudomonas stutzeri RCH2

Annotation: Mig-14.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 PF07395: Mig-14" amino acids 35 to 298 (264 residues), 404.9 bits, see alignment E=1.5e-125 PF13480: Acetyltransf_6" amino acids 143 to 286 (144 residues), 40.2 bits, see alignment E=3.8e-14

Best Hits

KEGG orthology group: None (inferred from 76% identity to pmy:Pmen_0595)

Predicted SEED Role

"Probable transcription regulator Mig-14"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GI49 at UniProt or InterPro

Protein Sequence (298 amino acids)

>Psest_0468 Mig-14. (Pseudomonas stutzeri RCH2)
MLQFLQSWRERGWRVIDASTYAEVWQRYGGSVATHPDVIERLARLADIPVRYLAWEQQGE
LIAAVPCWGRHLALSKDVLKKTGKRGLFDMGNAEIILPVAERADVPVRQRMRYVSELNAA
AISTLREQPEGLALAREPEAYSKKFRYNQRREQRLLEEAGGVLRPLLDFAPTEQAAMYAD
LFQRRWGFEAPGKAHLHEVFELLREFMTGSVVLLDEQPIAVQVLYRVEAPKWVSIEYING
GVDPQQRDFSPGSVLSFVNTQTAWAEARALGKPLRYSFGRADREYKDRWCNRVPVYQV