Protein Info for Psest_0464 in Pseudomonas stutzeri RCH2

Annotation: Mannosyltransferase OCH1 and related enzymes

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 PF04488: Gly_transf_sug" amino acids 21 to 96 (76 residues), 45.4 bits, see alignment E=5.4e-16

Best Hits

Predicted SEED Role

"Putative mannosyltransferase involved in polysaccharide biosynthesis"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GGE5 at UniProt or InterPro

Protein Sequence (242 amino acids)

>Psest_0464 Mannosyltransferase OCH1 and related enzymes (Pseudomonas stutzeri RCH2)
MIPRKLHYCWFGGRSMPLQAQLCMASWAYRLPDYEVVRWDEQRFDSASHPFTAAAYAAGR
YAFVSDYVRMHALLHEGGIYLDVDVEVLASLDGCLDDDFFIGLEDRQRFATSLIGARAGH
WLPRDMLAYYDRTAFEVNRLSNLVNVNEVSRLLLARGFSGRGAEELRAGERVYAIGAFGA
ARPELACAPRVFAKHLFAGTWRSNRDKSWLSLGWRRLRKLPETFFILARLGCYRLLSRLK
KS