Protein Info for HP15_447 in Marinobacter adhaerens HP15

Annotation: glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF13439: Glyco_transf_4" amino acids 13 to 165 (153 residues), 112.4 bits, see alignment E=7.5e-36 PF13579: Glyco_trans_4_4" amino acids 13 to 161 (149 residues), 50.1 bits, see alignment E=1.2e-16 PF13477: Glyco_trans_4_2" amino acids 19 to 125 (107 residues), 28.3 bits, see alignment E=5.6e-10 PF20706: GT4-conflict" amino acids 125 to 320 (196 residues), 40.7 bits, see alignment E=4.9e-14 PF00534: Glycos_transf_1" amino acids 180 to 336 (157 residues), 105.5 bits, see alignment E=6.9e-34 PF13692: Glyco_trans_1_4" amino acids 191 to 335 (145 residues), 88.5 bits, see alignment E=1.6e-28

Best Hits

KEGG orthology group: None (inferred from 78% identity to maq:Maqu_0798)

Predicted SEED Role

"Glycosyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PMT3 at UniProt or InterPro

Protein Sequence (371 amino acids)

>HP15_447 glycosyltransferase (Marinobacter adhaerens HP15)
MRILQALPALYSGGVERGTVEFAADLVQRGHESFVVSKGGPMAEQLRGQGSRHIFMPIHR
KNPASFGQILPMRKLLLELKPDIVHVRSRMPAWIIFLALKSIPKRERPAVVSTFHGMYSV
TPYSAIMTRADHIIAVSQCVRDYVMSNYQVPEEKLTVIQRGVDVDAFHQRELPQQWLDRW
FRQYPQLAGKKIIMMPGRISRWKGQLDFLAMMAKLVRERPDCHGIIVGGAEPGKEHFLDE
LEKERSRLDLTEKVSFLGQRNDMTNLYLLSDVVCHMSTKPEPFGRTVTEALASGTPVVAY
NRGGAAETLQACFREGLVAPDNVEEFAQAVSRMLDAGPPAIEIPYRFRLEAQTEASLAVY
ETVLQNAAGRS