Protein Info for HP15_446 in Marinobacter adhaerens HP15

Annotation: glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF13439: Glyco_transf_4" amino acids 20 to 154 (135 residues), 65.8 bits, see alignment E=1.5e-21 PF13579: Glyco_trans_4_4" amino acids 21 to 116 (96 residues), 46.1 bits, see alignment E=2e-15 PF13477: Glyco_trans_4_2" amino acids 24 to 118 (95 residues), 40 bits, see alignment E=1.4e-13 PF20706: GT4-conflict" amino acids 126 to 295 (170 residues), 39.7 bits, see alignment E=9.3e-14 PF13692: Glyco_trans_1_4" amino acids 174 to 309 (136 residues), 85.6 bits, see alignment E=1.2e-27 PF00534: Glycos_transf_1" amino acids 175 to 315 (141 residues), 93.9 bits, see alignment E=2.5e-30

Best Hits

Predicted SEED Role

"Poly(glycerol-phosphate) alpha-glucosyltransferase (EC 2.4.1.52)" in subsystem Teichoic and lipoteichoic acids biosynthesis (EC 2.4.1.52)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.52

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PMT2 at UniProt or InterPro

Protein Sequence (351 amino acids)

>HP15_446 glycosyltransferase (Marinobacter adhaerens HP15)
MTSPPRLTIALLIATPGTTWGGMEKHTADLAGALADRGHIVHVIGHKTYRDRFPAGVQFH
PLPVQLGRRNLWLQLALRRRLREIAPDILHAQGNKAAQLAAKTGSLARVRIGTVHGTKSS
HKAFDRLDEIIAVSPRILATLRHHRKHLIYNGVESGSERTTTDDGPELPSVVTNVIAVGR
LESVKGFDALIRAWAMLGDSAHRCHLTIFGEGSQRSRLEHLIRQLKLETSVTLAGFRENL
APIYDRAELTVISSEREGFPYVLAESLLSGCPVVSTPVSGPRDILPATSLSAGHRDQDLA
ELIARALADLETLKQSEQPAMAFARKTLTINAMAEQTEALYLRAMGEQRGT