Protein Info for Psest_0460 in Pseudomonas stutzeri RCH2

Annotation: Glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 PF13439: Glyco_transf_4" amino acids 58 to 179 (122 residues), 34.2 bits, see alignment E=4e-12 PF00534: Glycos_transf_1" amino acids 191 to 336 (146 residues), 101.2 bits, see alignment E=7.5e-33 PF13692: Glyco_trans_1_4" amino acids 203 to 336 (134 residues), 93.9 bits, see alignment E=1.7e-30

Best Hits

KEGG orthology group: None (inferred from 85% identity to pmy:Pmen_0587)

Predicted SEED Role

"Glycosyl transferase in large core OS assembly cluster"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GH31 at UniProt or InterPro

Protein Sequence (377 amino acids)

>Psest_0460 Glycosyltransferase (Pseudomonas stutzeri RCH2)
MTTIERLPDQTRRWVLQFCHGYDGPFLDCARQYAALFKGTTYKVCTVYLTGEPSVEVERG
SASDEVIFLDYSSAQVRGLKLRAIRDLRRIAVSRDFALCVAHRFKPIYVALLGSNLPVIG
VHHAFGDYKRRSRQIFANFFRKRLALLGVSNAVRDDMRACLPAWPADRIETLYNRIDVEA
VQAEQVSREVARDHLCLPQDAWVVGNVGRLHPDKDQATLICGFAQALPQMPVGSLLAIMG
SGKLEGSLRALAAELGVTESVRFLGQMPNGRRYFKAFDLFVLTSDHEPFGMVLLEAMAAG
VPVVGTDCGGGREVVQGAGELFPRGDASALAEVLQRQAQIVDLPALRERMQTHLQQRFSD
PVVRERFWSLSLLAMLS